PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00798g00318.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family G2-like
Protein Properties Length: 299aa    MW: 32884.6 Da    PI: 7.2882
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00798g00318.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like105.62.9e-3349103155
                   G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                               k+rlrW++eLHerFv+av+qLGG+++AtPk +l++m+v+gLt++hvkSHLQkYRl
  Peaxi162Scf00798g00318.1  49 KQRLRWNNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRL 103
                               79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.25446106IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.2E-3148104IPR009057Homeodomain-like
SuperFamilySSF466895.91E-1748103IPR009057Homeodomain-like
TIGRFAMsTIGR015572.6E-2549104IPR006447Myb domain, plants
PfamPF002491.9E-851102IPR001005SANT/Myb domain
PfamPF143792.6E-22117163IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MYQPKGVPSP SLVHNNAAVH SQSLECGGGS MDPISGGNNA NNNASLASKQ RLRWNNELHE  60
RFVDAVAQLG GPDRATPKGV LRVMGVQGLT IYHVKSHLQK YRLAKYLPDS SSDGRGVEIT  120
TALKLQMEVQ KRLHEQLEVQ KQLQLRIEAQ GKYLKKIIEE QQRLSGVLSE VPGSGVTAPP  180
TGDNDPESDN RTDPGTPAPT SESPHVDKPV KAHPPTKSHS MDESFSSHHE PLTSDSDYQD  240
TSPMESPNSE RSSKKQRVGT SAAFMKDNAL LPHQIVESSL SRHQQPHSVF MTRDQFNHD
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00252DAPTransfer from AT2G01060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016556346.10.0PREDICTED: protein PHR1-LIKE 1
TrEMBLM1ABL41e-178M1ABL4_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000190991e-177(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27962451
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.11e-101G2-like family protein